biological source:
rabbit
Quality Level: 100
Conjugate: unconjugated
antibody form: affinity
isolated antibody
antibody product type:
primary antibodies
clone: polyclonal
product line: Prestige
Antibodies® Powered by Atlas Antibodies
form: buffered
aqueous glycerol solution
species reactivity:
human
concentration: 0.1 mg/mL
technique(s): immunofluorescence:
0.25-2 μg/mL (ICC-IF)
isotype: IgG
immunogen sequence:
LPGCQICQQLVRCFCGRLVKQHACFTASLAMKYSDVKLGDHFNQAIEEWSVEKHTEQSPTDAYGVINFQGGSHSYR
Ensembl | human accession no.: ENSG00000092439
shipped in: wet
ice
storage temp.: −20°C
target post-translational modification: unmodified
Gene Information: human
... TRPM7(54822)
Immunogen
transient receptor potential cation channel subfamily M
member 7
Application
All Prestige Antibodies Powered by Atlas Antibodies are
developed and validated by the Human
Protein Atlas (HPA) project and as a result, are supported by the
most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human
Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been
generated in support of the Tissue and Cancer Atlas projects have been tested
by immunohistochemistry against hundreds of normal and disease tissues and
through the recent efforts of the Human Cell Atlas project, many have been
characterized by immunofluorescence to map the human proteome not only at the
tissue level but now at the subcellular level. These images and the collection
of this vast data set can be viewed on the Human Protein Atlas (HPA) site by
clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and
other useful information.
Features and Benefits
Prestige Antibodies® are highly
characterized and extensively validated antibodies with the added benefit of
all available characterization data for each target being accessible via the
Human Protein Atlas portal linked just below the product name at the top of
this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to
other proteins are due to a thorough selection of antigen regions, affinity
purification, and stringent selection. Prestige antigen controls are available
for every corresponding Prestige Antibody and can be found in the linkage
section.
Every Prestige Antibody is tested in the following ways:
- IHC
tissue array of 44 normal human tissues and 20 of the most common cancer
type tissues.
- Protein
array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing
40% glycerol and 0.02% sodium azide.
Other Notes
Corresponding Antigen APREST94632
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA,
Darmstadt, Germany
